PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G324800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 189aa    MW: 21800.3 Da    PI: 9.0862
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G324800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK856.6e-2765115252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +k +++e +s++F +pik+AA+eL+v++TvLK++CR++GI+RWPhRk+ksl
  Sevir.1G324800.1.p  65 KKALTFELVSRHFCMPIKQAAQELNVGVTVLKKRCRELGIPRWPHRKVKSL 115
                         689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.88253135IPR003035RWP-RK domain
PfamPF020421.5E-2268115IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MNLYELGCLS EVDFASFWAQ VEEDDARRKS KEGDCEKALI KLEPGSGSVQ KCAEMQGHRR  60
SVLGKKALTF ELVSRHFCMP IKQAAQELNV GVTVLKKRCR ELGIPRWPHR KVKSLQTLID  120
NIQELGKLTE QEDGNLTKSK VESLQQEKKL IEERPEVMLD ERTKELRQMC FKEKFKRRQQ  180
LIMGHGTW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955211.21e-119PREDICTED: protein RKD3-like
SwissprotQ9M9U97e-36RKD1_ARATH; Protein RKD1
TrEMBLK3YY091e-118K3YY09_SETIT; Uncharacterized protein
STRINGSi019159m1e-118(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-37RWP-RK domain-containing protein